PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA005934-PA
Common NameOsI_08282
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Trihelix
Protein Properties Length: 570aa    MW: 61786.4 Da    PI: 4.4586
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA005934-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.42.2e-2988172187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+++e+laLi++r+em+ ++r++ lk+p Wee s++++e g++rs k+Ckek+en+ k+yk++keg+ +r++++s  +++f+qlea
  BGIOSGA005934-PA  88 RWPREETLALIRIRSEMDAAFRNATLKAPVWEELSRRLAELGYQRSGKKCKEKFENVDKYYKRTKEGRTGRQDGKS--YRFFSQLEA 172
                       8*********************************************************************866665..*******85 PP

2trihelix108.25.5e-34337422187
          trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                       rW+k+ev+aLi++r e+ee++++   k+plWee+++ m++ g++rs+k+Ckekwen+nk++kk+ke++k+r +e+s+tcpyf+ql+a
  BGIOSGA005934-PA 337 RWPKEEVQALIDLRMEKEEQYNDMGPKGPLWEEIAAGMQRIGYNRSAKRCKEKWENINKYFKKVKESNKRR-PEDSKTCPYFHQLDA 422
                       8********************************************************************97.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.2285147IPR001005SANT/Myb domain
PfamPF138374.9E-2187173No hitNo description
CDDcd122032.42E-2787152No hitNo description
PROSITE profilePS500907.08587145IPR017877Myb-like domain
SMARTSM007171.0E-5334396IPR001005SANT/Myb domain
PROSITE profilePS500907.851336394IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.604.4E-5336393IPR009057Homeodomain-like
SuperFamilySSF466897.43E-5336404IPR009057Homeodomain-like
CDDcd122036.53E-27336401No hitNo description
PfamPF138372.1E-22337423No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MQHPQGAGDP PYGVVPAPPT MAAAFDLPPV TTPAPAAPSD VLLPTQPQVS GPEEFPAAAV  60
NSNDDDMMMV DDVVVAGGVG GSGSTGNRWP REETLALIRI RSEMDAAFRN ATLKAPVWEE  120
LSRRLAELGY QRSGKKCKEK FENVDKYYKR TKEGRTGRQD GKSYRFFSQL EALHAAAPPP  180
PPQQRQGMPV EDPQPLAMAR MMLPGAADLG FLSMSSESES DDESDEEEEE EEEEAVAPGG  240
GGREGLGDDG DGDGEGGSST RKLMAMFEGM MRQVTEKQDA MQRVFLETLE KWEAERTERE  300
EAWRRKELVP VPAPRAKAED AWAAAGGDGS GTTAPSRWPK EEVQALIDLR MEKEEQYNDM  360
GPKGPLWEEI AAGMQRIGYN RSAKRCKEKW ENINKYFKKV KESNKRRPED SKTCPYFHQL  420
DAIYRKKHFA GRGGGGGGVT IAASHSSLAI VTVSEQDNPS QRELEGKSSN DVGNVQLAVP  480
LLVHNAPDKK VEGSEGEPNV TAAAEETDSD EMGGEYTDDG DDDDKMQYKI EFQKPTAGGG  540
GDGNDAPVPA TTAAATSSAP TSNTSFLAVQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.134660.0callus| flower| panicle| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO379884050.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1117420.0AK111742.1 Oryza sativa Japonica Group cDNA clone:J023050K14, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622654.10.0PREDICTED: trihelix transcription factor GTL1
TrEMBLB8AG140.0B8AG14_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA005934-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60638175
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.14e-44Trihelix family protein